Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable dipeptidase pepE (pepE)

This Recombinant Probable dipeptidase pepE (pepE) spans the amino acid sequence from region 1-375.

Product Specifications

Product Name Alternative

Probable dipeptidase pepE, EC= 3.4.13.-

UniProt

P65811

Expression Region

1-375

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSRRFDAEVYARRLALAAAATADAGLAGLVITPGYDLCYLIGSRAETFERLTALVLPAA GAPAVVLPRLELAALKQSAAAELGLRVCDWVDGDDPYGLVSAVLGGAPVATAVTDSMPAL HMLPLADALGVLPVLATDVLRRLRMVKEETEIDALRKAGAAIDRVHARVPEFLVPGRTEA DVAADIAEAIVAEGHSEVAFVIVGSGPHGADPHHGYSDRELREGDIVVVDIGGTYGPGYH SDSTRTYSIGEPDSDVAQSYSMLQRAQRAAFEAIRPGVTAEQVDAAARDVLAEAGLAEYF VHRTGHGIGLCVHEEPYIVAGNDLVLVPGMAFSIEPGIYFPGRWGARIEDIVIVTEDGAV SVNNCPHELIVVPVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kallikrein 4 (7S Nerve Growth Factor alpha Chain, AI2A1, Alpha-NGF, Androgen-regulated Message 1, ARM1, EMSP 1, EMSP, EMSP1, Enamel Matrix Serine Protease 1, Enamel Matrix Serine Proteinase 1, HK4, Kallikrein 1-related Peptidase-like b4, Kallikrein 4 (Prostase, Enamel Matrix, Prostate), Kallikrein, Kallikrein L1, Kallikrein Like Protein 1, Kallikrein Related-peptidase 4 (Prostase, Enamel Matrix, Prostate), Kallikrein-4, Kallikrein-like Protein 1, Kallikrein-related Peptidase 4, KLK 4, KLK L1, KLK-L1, KLK4, KLK4_HUMAN, Prostase, Protease Serine 17, PRSS 17, PRSS17, PSTS, Serine Protease 17)
303410 100 µg

Kallikrein 4 (7S Nerve Growth Factor alpha Chain, AI2A1, Alpha-NGF, Androgen-regulated Message 1, ARM1, EMSP 1, EMSP, EMSP1, Enamel Matrix Serine Protease 1, Enamel Matrix Serine Proteinase 1, HK4, Kallikrein 1-related Peptidase-like b4, Kallikrein 4 (Prostase, Enamel Matrix, Prostate), Kallikrein, Kallikrein L1, Kallikrein Like Protein 1, Kallikrein Related-peptidase 4 (Prostase, Enamel Matrix, Prostate), Kallikrein-4, Kallikrein-like Protein 1, Kallikrein-related Peptidase 4, KLK 4, KLK L1, KLK-L1, KLK4, KLK4_HUMAN, Prostase, Protease Serine 17, PRSS 17, PRSS17, PSTS, Serine Protease 17)

Sign In for Pricing
View Details
SMIM3 Recombinant Protein Antigen
NBP2-57947PEP 100 µL

SMIM3 Recombinant Protein Antigen

Sign In for Pricing
View Details
FKSG2 antibody
70R-51424 100 ul

FKSG2 antibody

Sign In for Pricing
View Details
Human Angiopoietin-like 3 MAb (Clone 388620)
MAB38291 500 µg

Human Angiopoietin-like 3 MAb (Clone 388620)

Sign In for Pricing
View Details
HNRNPA1 (Ab-192) Antibody
A58032-100UL 100 µL

HNRNPA1 (Ab-192) Antibody

Sign In for Pricing
View Details
Splicing factor 1 (SF1) Mouse Monoclonal Antibody [Clone ID: LBI4C9]
AMM19019VCF 100 µg

Splicing factor 1 (SF1) Mouse Monoclonal Antibody [Clone ID: LBI4C9]

Sign In for Pricing
View Details