Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bombyx mori nuclear polyhedrosis virus Occlusion-derived virus envelope protein E56 (ODVP6E)

This Recombinant Bombyx mori nuclear polyhedrosis virus Occlusion-derived virus envelope protein E56 (ODVP6E) spans the amino acid sequence from region 1-375.

Product Specifications

Product Name Alternative

Occlusion-derived virus envelope protein E56, ODV-E56, ODVP-6E

UniProt

O92500

Expression Region

1-375

Origin

Bombyx mori nuclear polyhedrosis virus (BmNPV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFFTNLRRVNKLYPNQASFLADNTRLLTSTPAGFTNVLNAPSVRNLGNNRYQPGYQLSN NRFVSTSDINRITRNNDVPNIRNVFQGISDPQINSLRQLRRMDNVPDFHYHTKQTRSNAV RQNFPETNVRTPEGVQNALQQNPRLHNHMRTLKVAGVGILLAGGGYLLFTASTLVQDIIN AINRTGGSYYVQGRNAGENVESCLLLQRTCRQDRNLAQSDVNICSRDPLLANDSPLLTNM CQGFNYETEKTVCRGSNPAANPNSPQYVDISDLPAGQTIMCIEPYSFSDLVGDLGLDWLL GREGLVGKSSNSSDGIRNKIMPIIMMIGAVLFLGLILYFIYRYMTKGGGGGGGSGGAPTP IVIMQHPASTTAPRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL
BNC880003-500 1x 500 µL

CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL
BNC400177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
BNC740149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
BNC470177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 (DOG1.1), CF740 conjugate, 0.1mg/mL
BNC740725-100 1x 100 µL

DOG-1 (DOG1.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1757), CF405S conjugate, 0.1mg/mL
BNC041757-500 1x 500 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1757), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details