Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bombyx mori nuclear polyhedrosis virus Occlusion-derived virus envelope protein E56 (ODVP6E)

This Recombinant Bombyx mori nuclear polyhedrosis virus Occlusion-derived virus envelope protein E56 (ODVP6E) spans the amino acid sequence from region 1-375.

Product Specifications

Product Name Alternative

Occlusion-derived virus envelope protein E56, ODV-E56, ODVP-6E

UniProt

O92500

Expression Region

1-375

Origin

Bombyx mori nuclear polyhedrosis virus (BmNPV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFFTNLRRVNKLYPNQASFLADNTRLLTSTPAGFTNVLNAPSVRNLGNNRYQPGYQLSN NRFVSTSDINRITRNNDVPNIRNVFQGISDPQINSLRQLRRMDNVPDFHYHTKQTRSNAV RQNFPETNVRTPEGVQNALQQNPRLHNHMRTLKVAGVGILLAGGGYLLFTASTLVQDIIN AINRTGGSYYVQGRNAGENVESCLLLQRTCRQDRNLAQSDVNICSRDPLLANDSPLLTNM CQGFNYETEKTVCRGSNPAANPNSPQYVDISDLPAGQTIMCIEPYSFSDLVGDLGLDWLL GREGLVGKSSNSSDGIRNKIMPIIMMIGAVLFLGLILYFIYRYMTKGGGGGGGSGGAPTP IVIMQHPASTTAPRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rno-miR-96-3p miRNA Inhibitor
MBS8297707-01 10 nmol

rno-miR-96-3p miRNA Inhibitor

Sign In for Pricing
View Details
rno-miR-96-3p miRNA Inhibitor
MBS8297707-02 20 nmol

rno-miR-96-3p miRNA Inhibitor

Sign In for Pricing
View Details
rno-miR-96-3p miRNA Inhibitor
MBS8297707-03 5x 20 nmol

rno-miR-96-3p miRNA Inhibitor

Sign In for Pricing
View Details
Anti-HMGA2 Antibody (C-term)
A00436-1-400ul 400 µL

Anti-HMGA2 Antibody (C-term)

Sign In for Pricing
View Details
Slfn2-set siRNA/shRNA/RNAi Lentivector (Mouse)
44356094 4x 500 ng

Slfn2-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
GAGE5 Human Gene Knockout Kit (CRISPR)
KN412463 1 Kit

GAGE5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details