Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis UPF0754 membrane protein SERP1382 (SERP1382)

This Recombinant Staphylococcus epidermidis UPF0754 membrane protein SERP1382 (SERP1382) spans the amino acid sequence from region 1-376.

Product Specifications

Product Name Alternative

UPF0754 membrane protein SERP1382

UniProt

Q5HN90

Expression Region

1-376

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHTILLVVFMIILGAIIGGVTNMIAIKMLFHPFKPYYIFRFRIPFTPGLIPKRREEIARK IGQVIEEHLITEELIRQKLNQPQSRNMIQQLIHKQISKLKNDDVTIKKIAGFLGIDVNEL VDYKLTTKFLNKLNFWYESNKYRKLSEILPQSFLDQCKGQIEYITDFLCERARNYLSSEK GERDIYELLDTFFNEKGRIIGLLQMFMTKESIADRIQHELIRLTQHPQSQKIITKVLNDE YETFKDKNLDEIIKEQQFKNYSQLVLNELKTYLNLKDKTERPIKQVVPQFIQFLEDDTSK RMTDFIIKGTSKHLTNIMKKINLRQLVEEQINTFDLKYIENLIIDIANKELKLIMTLGFI LGGIIGFFQGVIAIFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF647 conjugate, 0.1mg/mL
BNC470322-500 1x 500 µL

CD3e (RIV9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-500 1x 500 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF405S conjugate, 0.1mg/mL
BNC040338-500 1x 500 µL

P53 (PAb122), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF568 conjugate, 0.1mg/mL
BNC680333-100 1x 100 µL

CD8 (RIV11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-500 1x 500 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX2 (Transcription Factor) (SOX2/1791), CF594 conjugate, 0.1mg/mL
BNC941791-100 1x 100 µL

SOX2 (Transcription Factor) (SOX2/1791), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details