Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Endoplasmic reticulum-Golgi intermediate compartment protein 2 (ergic2)

This Recombinant Danio rerio Endoplasmic reticulum-Golgi intermediate compartment protein 2 (ergic2) spans the amino acid sequence from region 1-376.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 2

UniProt

Q7T2D4

Expression Region

1-376

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRLNKKKALNFVRELDAFPKVPESYVETTASGGTVSLLAFTAMALLAFFEFFVYRDTWM KYEYEVDKDFTSKLRINIDITVAMRCQFVGADVLDLAETMVASDGLVYEPVVFDLSPQQR LWHRTLLLIQGRLREEHSLQDVLFKNVMKGSPTALPPREDDPNQPLNACRIHGHLYVNKV AGNFHITVGKAIPHPRGHAHLAALVSHETYNFSHRIDHLSFGEEIPGILNPLDGTEKVSA DHNQMFQYFITIVPTKLQTYKVYADTHQYSVTERERVINHAAGSHGVSGIFMKYDISSLM VKVTEQHMPFWQFLVRLCGIIGGIFSTTGMLHNLVGFCVDVVCCRFKLGVYKPKSMSDFD GQINSLTPLLSENAEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Glutamate Receptor 1 Rabbit Monoclonal Antibody
MA2832-.1 100 µL

Anti-Glutamate Receptor 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS507705 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Anti-PCDHB14 Antibody Picoband® (Biotine Conjugate)
A13272-1-Biotin 100 µg/Vial

Anti-PCDHB14 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
AID CRISPR Activation Plasmid (h)
sc-401542-ACT 20 µg

AID CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
CDK10 (Cyclin-dependent Kinase 10, PISSLRE, CDC2-related Protein Kinase, Cell Division Protein Kinase 10, Cyclin-dependent Kinase (CDC2-like) 10, Cyclin-dependent Kinase Related Protein, Serine/Threonine Protein Kinase PISSLRE)
208063 100 µg

CDK10 (Cyclin-dependent Kinase 10, PISSLRE, CDC2-related Protein Kinase, Cell Division Protein Kinase 10, Cyclin-dependent Kinase (CDC2-like) 10, Cyclin-dependent Kinase Related Protein, Serine/Threonine Protein Kinase PISSLRE)

Sign In for Pricing
View Details
ANPEP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0096608 1.0 µg DNA

ANPEP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details