Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Endoplasmic reticulum-Golgi intermediate compartment protein 2 (ergic2)

This Recombinant Danio rerio Endoplasmic reticulum-Golgi intermediate compartment protein 2 (ergic2) spans the amino acid sequence from region 1-376.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 2

UniProt

Q7T2D4

Expression Region

1-376

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRLNKKKALNFVRELDAFPKVPESYVETTASGGTVSLLAFTAMALLAFFEFFVYRDTWM KYEYEVDKDFTSKLRINIDITVAMRCQFVGADVLDLAETMVASDGLVYEPVVFDLSPQQR LWHRTLLLIQGRLREEHSLQDVLFKNVMKGSPTALPPREDDPNQPLNACRIHGHLYVNKV AGNFHITVGKAIPHPRGHAHLAALVSHETYNFSHRIDHLSFGEEIPGILNPLDGTEKVSA DHNQMFQYFITIVPTKLQTYKVYADTHQYSVTERERVINHAAGSHGVSGIFMKYDISSLM VKVTEQHMPFWQFLVRLCGIIGGIFSTTGMLHNLVGFCVDVVCCRFKLGVYKPKSMSDFD GQINSLTPLLSENAEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRC1 shRNA Plasmid (m)
sc-44346-SH 20 µg

PRC1 shRNA Plasmid (m)

Sign In for Pricing
View Details
COG4 (NM_015386) Human Over-expression Lysate
LH09648V 100 µg

COG4 (NM_015386) Human Over-expression Lysate

Sign In for Pricing
View Details
ARSH Polyclonal Antibody
UB-GEN-5198 100 µL

ARSH Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human SRRM2 pAb
PA9672-01 50 μL

Rabbit Anti-Human SRRM2 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human SRRM2 pAb
PA9672-02 100 μL

Rabbit Anti-Human SRRM2 pAb

Sign In for Pricing
View Details
His-Tag (D3I1O) XP® Rabbit Monoclonal Antibody (Alexa Fluor® 488 Conjugate)
CST 14930S 100 µL

His-Tag (D3I1O) XP® Rabbit Monoclonal Antibody (Alexa Fluor® 488 Conjugate)

Sign In for Pricing
View Details