Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Endoplasmic reticulum-Golgi intermediate compartment protein 2 (ergic2)

This Recombinant Danio rerio Endoplasmic reticulum-Golgi intermediate compartment protein 2 (ergic2) spans the amino acid sequence from region 1-376.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 2

UniProt

Q7T2D4

Expression Region

1-376

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRLNKKKALNFVRELDAFPKVPESYVETTASGGTVSLLAFTAMALLAFFEFFVYRDTWM KYEYEVDKDFTSKLRINIDITVAMRCQFVGADVLDLAETMVASDGLVYEPVVFDLSPQQR LWHRTLLLIQGRLREEHSLQDVLFKNVMKGSPTALPPREDDPNQPLNACRIHGHLYVNKV AGNFHITVGKAIPHPRGHAHLAALVSHETYNFSHRIDHLSFGEEIPGILNPLDGTEKVSA DHNQMFQYFITIVPTKLQTYKVYADTHQYSVTERERVINHAAGSHGVSGIFMKYDISSLM VKVTEQHMPFWQFLVRLCGIIGGIFSTTGMLHNLVGFCVDVVCCRFKLGVYKPKSMSDFD GQINSLTPLLSENAEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Serine Dehydratase Antibody (OTI3D3) [PerCP]
NBP2-74074PCP 0.1 mL

Mouse Monoclonal Serine Dehydratase Antibody (OTI3D3) [PerCP]

Sign In for Pricing
View Details
SPOCK1 ORF Vector (Human) (pORF)
ORF009985 1.0 µg DNA

SPOCK1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rivoglitazone HCl
MBS5778220-01 5 mg

Rivoglitazone HCl

Sign In for Pricing
View Details
Rivoglitazone HCl
MBS5778220-02 5x 5 mg

Rivoglitazone HCl

Sign In for Pricing
View Details
EIF4B (Eukaryotic Translation Initiation Factor 4B, EIF-4B, PRO1843) (MaxLight 490)
MBS6415546-01 0.1 mL

EIF4B (Eukaryotic Translation Initiation Factor 4B, EIF-4B, PRO1843) (MaxLight 490)

Sign In for Pricing
View Details
EIF4B (Eukaryotic Translation Initiation Factor 4B, EIF-4B, PRO1843) (MaxLight 490)
MBS6415546-02 5x 0.1 mL

EIF4B (Eukaryotic Translation Initiation Factor 4B, EIF-4B, PRO1843) (MaxLight 490)

Sign In for Pricing
View Details