Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Autographa californica nuclear polyhedrosis virus Occlusion-derived virus envelope protein E56 (ODVP6E)

This Recombinant Autographa californica nuclear polyhedrosis virus Occlusion-derived virus envelope protein E56 (ODVP6E) spans the amino acid sequence from region 1-376.

Product Specifications

Product Name Alternative

Occlusion-derived virus envelope protein E56, ODV-E56, ODVP-6E

UniProt

P41705

Expression Region

1-376

Origin

Autographa californica nuclear polyhedrosis virus (AcMNPV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFFSNLRAVNKLYPNQASFITDNTRLLTSTPAGFTNVLNAPSVRNIGNNRFQPGYQLSN NQFVSTSDINRITRNNDVPNIRGVFQGISDPQINSLSQLRRVDNVPDFNYHTKQTRSNAV KQNFPETNVRTPEGVQNALQQNPRLHSYMQSLKVGGTGILLATGGYFLFSAATLVQDIIN AINNTGGSYYVQGKDAGEIAEACLLLQRTCRQDPNLNQSDVTICPFDPLLPNNPPELTNM CQGFNYEVEKTVCRGSDPSADPDSPQYVDISDLPAGQTLMCIEPYSFGDLVGDLGLDWLL GDEGLVGKSSNVSDSVSGKLMPIILLIGAVLFLGLIFYFIYRYMMKGGGGGGVGAATSPT PIVISMQNPTPTTAPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACY1 Antibody
KC-21319-01 50 μL

ACY1 Antibody

Sign In for Pricing
View Details
ACY1 Antibody
KC-21319-02 100 µL

ACY1 Antibody

Sign In for Pricing
View Details
ACY1 Antibody
KC-21319-03 1 mL

ACY1 Antibody

Sign In for Pricing
View Details
Recombinant Mouse CXCL3/GRO gamma Protein (His Tag)
PKSM040283 100 µg

Recombinant Mouse CXCL3/GRO gamma Protein (His Tag)

Sign In for Pricing
View Details
CDH18 (NM_004934) Human Over-expression Lysate
LC401535 20 µg

CDH18 (NM_004934) Human Over-expression Lysate

Sign In for Pricing
View Details
MSH6 (DNA Mismatch Repair Protein) (MSH6/3089), CF647 conjugate, 0.1mg/mL
BNC473089-500 1x 500 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/3089), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details