Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium tumefaciens Protein virB10 (virB10)

This Recombinant Agrobacterium tumefaciens Protein virB10 (virB10) spans the amino acid sequence from region 1-377.

Product Specifications

Product Name Alternative

Protein virB10

UniProt

P05359

Expression Region

1-377

Origin

Agrobacterium tumefaciens (strain 15955)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNDSQQAAHEVDASGSLVSDKHRRRLSGSQKLIVGGVVLALSLSLIWLGGRQKKVNDNA SPSTLIAANTKPFHPAPIEVPPDTPAVQEAVQPTVPQPPRGEPERHEPRPEETPIFAYSS GDQGVSKRASQGDMGRRQEDKRDDNSLPNGEVSGENDLSIRMKPTELQPSRATLLPHPDF MVTQGTIIPCILQTAIDTNLAGYVKCVLPQDIRGTTNNIVLLDRGTTVVGEIQRGLQQGD ERVFVLWDRAETPDHAMISLTSPSADELGRPGLPGSVDSHFWQRFSGAMLLSAVQGAFQA ASTYAGSSGGGMSFNSFQNNGEQTTETALKATINIPPTLKKNQGDTVSIFVARDLDFFGV YQLRLTGGAARGRNRRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF740 conjugate, 0.1mg/mL
BNC740851-500 1x 500 µL

HSP60 (LK1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
BNC680994-500 1x 500 µL

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF740 conjugate, 0.1mg/mL
BNC740871-500 1x 500 µL

CD71 (66IG10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL
BNC470270-500 1x 500 µL

Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL
BNC041429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
BNC682853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details