Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis UPF0754 membrane protein yheB (yheB)

This Recombinant Bacillus subtilis UPF0754 membrane protein yheB (yheB) spans the amino acid sequence from region 1-377.

Product Specifications

Product Name Alternative

UPF0754 membrane protein yheB

UniProt

O07543

Expression Region

1-377

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGIAGTFIFMIVIGAAIGAVTNHLAIQMLFRPYKAYYLFGKRVPFTPGLIPRRRDELAKQ MGLMVVNHLLTPEGIKKRLVSDAAKTQALRVGEQLIQKLSLSEVTVKEALEKAGMKRPEK AADAWISSWTDDKLHELFRQYGDQSLKELVPIEVQEKLEEKIPMISGYILSRSVRYFESD EGKIRLGNMIDDFLKERGMLGSMVQLFLGNSSLADRVLPELLKFLRNEETNKLLSDLLKN EWGKLREYTFNEADEKWNAKALIFSLKRRVLQAFSTAPFFNNTIGTLTVRYESELTQQML PALLDKLLEGISSNLESVLKRLRLEEIVKEQVDQFPVERLEEMVLSISKKEFKMITYLGG LLGGIIGAIQALFVILF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
BNC740304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL
BNC470669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 6 (LHK6), CF647 conjugate, 0.1mg/mL
BNC470675-500 1x 500 µL

Cytokeratin 6 (LHK6), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2990R), CF568 conjugate, 0.1mg/mL
BNC682990-100 1x 100 µL

CD63 (Late Endosomes Marker) (LAMP3/2990R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF640R conjugate, 0.1mg/mL
BNC402074-500 1x 500 µL

Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details