Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Treponema pallidum Uncharacterized protein TP_0783 (TP_0783)

This Recombinant Treponema pallidum Uncharacterized protein TP_0783 (TP_0783) spans the amino acid sequence from region 1-377.

Product Specifications

Product Name Alternative

Uncharacterized protein TP_0783

UniProt

O83762

Expression Region

1-377

Origin

Treponema pallidum (strain Nichols)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKEIARHCTFSPMKIKEKKGYFISFSALFLIAYMFVAAVPLGADPYFLPIWARDLASELH XERPERAVRVNADTVQTLQPFMVGEYFGYFTDZGSVVFATRVTQRLSASTHAWAVYPEHA VRTPVFNPAGEHLAEIAEPGFVHIEADRFFLFSPGGNAVSSYDARGVQRWRVLHTAPITA FHSSAAGAVIGFSDGKVMVVRADGTVRCAFYPGGSTYEIVFGVTLSADGTLAACVCGLDR QRVILVSLADVQCKIVHHQYLEGALRHQLLMNFDTEGRYVVFEHAQGVGVIDCQRLETNI IPLVGDVVGMGVQPECDVVTVLSQKEQRCRFAVFERAVHRVGDVRFDAQDVSLTQGEKKF FLSIDMLLARIDIAGIP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS705952 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
DTHD1 Human Gene Knockout Kit (CRISPR)
KN426939 1 Kit

DTHD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MSF (SEPT9) Mouse Monoclonal Antibody [Clone ID: OTI13A11]
CF812817 100 µg

MSF (SEPT9) Mouse Monoclonal Antibody [Clone ID: OTI13A11]

Sign In for Pricing
View Details
UBE2E3 Human Gene Knockout Kit (CRISPR)
KN400274 1 Kit

UBE2E3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Procollagen Lysine-2-Oxoglutarate-5-Dioxygenase 2 (PLOD2) ELISA Kit
RD-PLOD2-Hu-01 96 Tests

Human Procollagen Lysine-2-Oxoglutarate-5-Dioxygenase 2 (PLOD2) ELISA Kit

Sign In for Pricing
View Details
Human Procollagen Lysine-2-Oxoglutarate-5-Dioxygenase 2 (PLOD2) ELISA Kit
RD-PLOD2-Hu-02 48 Tests

Human Procollagen Lysine-2-Oxoglutarate-5-Dioxygenase 2 (PLOD2) ELISA Kit

Sign In for Pricing
View Details