Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0835 (MJ0835)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0835 (MJ0835) spans the amino acid sequence from region 1-377.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0835

UniProt

Q58245

Expression Region

1-377

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVDTSKIKALKEKSRRTVKSGSLKFILIILVVVIVGLLAFIAYNEISNLQFQEKITLENQ KKAAIESINQMFAKYPNDPQKLIYINKIQMANNIEEINEVLEEAKKYISFKNYKIEAINQ IKSMYGEYYSLSLSAQELVHKISLAQSTEEIENLLKSVDIEKDIRSIIEKQIDYVLASGD KYYYVEINGKSMFMTRDEILKYKKFWTLSELKSLKITPVSQLNKVAIEISAKQCGKLPHK GDIISIYSKDGSFITYGIIDSSYVILSSISYSESKSTSSNINELGESYSSSSSSSISYSL NNLPGILHATVIDRLDYDKIKKMFGEYGKKLNEIEDDTQIFDENVNYFLIISIPDDKIPD IIQIDPKDIVIVIKSKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RBM17/SPF45 Antibody (N219/5)
MBS1571797-01 0.1 mg

Anti-RBM17/SPF45 Antibody (N219/5)

Sign In for Pricing
View Details
Anti-RBM17/SPF45 Antibody (N219/5)
MBS1571797-02 1 mg

Anti-RBM17/SPF45 Antibody (N219/5)

Sign In for Pricing
View Details
Anti-RBM17/SPF45 Antibody (N219/5)
MBS1571797-03 5x 1 mg

Anti-RBM17/SPF45 Antibody (N219/5)

Sign In for Pricing
View Details
SRRD 3'UTR GFP Stable Cell Line
TU074620 1.0 mL

SRRD 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal PIP5K2 alpha Antibody (3A3)
H00005305-M01 0.1 mg

Mouse Monoclonal PIP5K2 alpha Antibody (3A3)

Sign In for Pricing
View Details
MDR1 (Multi Drug Resistance Protein 1, ABC20, ATP Binding Cassette Subfamily B (MDR/TAP) Member 1, ABCB1, CD243, CLCS, GP170, P-Glycoprotein, P-gp, P Glycoprotein 1, PGY1) discontinued
M2825-15B 50 µg

MDR1 (Multi Drug Resistance Protein 1, ABC20, ATP Binding Cassette Subfamily B (MDR/TAP) Member 1, ABCB1, CD243, CLCS, GP170, P-Glycoprotein, P-gp, P Glycoprotein 1, PGY1) discontinued

Sign In for Pricing
View Details