Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gecko japonicus Endoplasmic reticulum-Golgi intermediate compartment protein 2 (ERGIC2)

This Recombinant Gecko japonicus Endoplasmic reticulum-Golgi intermediate compartment protein 2 (ERGIC2) spans the amino acid sequence from region 1-377.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 2

UniProt

Q5EHU7

Expression Region

1-377

Origin

Gecko japonicus (Japanese gecko)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRLNRKKTLSLVKELDAFPKVPDSYVETSASGGTVSLIAFTTMALLTIMEFSVYQDTWM KYEYEVDKDFSSKLRINIDITVAMKCQYVGADVLDLAETMVASTDGLVYEPAIFDLSPQQ KEWQRMLQRIQSRLQEEHSLQDVIFKSTFKSASTALPPREDDSSQPPDACRIHGHLYVNK VAGNFHITVGKAIPHPRGHAHLAALVNHDSYNFSHRIDHLSFGELVPGIINPLDGTEKIA LDHNQMFQYFITVVPTKLHTYKISADTHQFSVTERERVINHAAGSHGVSGIFMKYDLSSL MVTVTEEHMPFWQFFVRLCGIVGGIFSTTGMLHGIGKFIVEIIYCRFRLGAYKPVNSVPY EDGHTDNHLPLLENNTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF740 conjugate, 0.1mg/mL
BNC740176-100 1x 100 µL

CD5 (Cris-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF594 conjugate, 0.1mg/mL
BNC940333-100 1x 100 µL

CD8 (RIV11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-500 1x 500 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF568 conjugate, 0.1mg/mL
BNC680176-100 1x 100 µL

CD5 (Cris-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL
BNC880304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (GROEL/730), CF568 conjugate, 0.1mg/mL
BNC680730-500 1x 500 µL

HSP60 (GROEL/730), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details