Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Endoplasmic reticulum-Golgi intermediate compartment protein 2 (ERGIC2)

This Recombinant Macaca fascicularis Endoplasmic reticulum-Golgi intermediate compartment protein 2 (ERGIC2) spans the amino acid sequence from region 1-377.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 2

UniProt

Q4R5C3

Expression Region

1-377

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRLNRKKTLSLVKELDAFPKVPESYVETSASGGTVSLIAFTTMALLTIMEFSVYQDTWM KYEYEVDKDFSSKLRINIDITVAMKCQYVGADVLDLAETMVASADGLVYEPAVFDLSPQQ KEWQRMLQLTQSRLQEEHSLQDVIFKSAFKSASTALPPREDDSSQSPDACRIHGHLYVNK VAGNFHITVGKAIPHPRGHAHLAALVNHESYNFSHRIDHLSFGELVPAIINPLDGTEKIA IDHNQMFQYFITVVPTKLHTYKISADTHQFSVTERERIINHAAGSHGVSGIFMKYDLSSL MVTVTEEHMPFWQFFVRLCGIVGGIFSTTGMLHGIGKFIVEIICCRFRLGSYKPVNSVPF EDGHTDNHLPLLENNTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MBP Rabbit Monoclonal Antibody
MBS1750153-01 0.03 mL

Anti-MBP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-MBP Rabbit Monoclonal Antibody
MBS1750153-02 0.1 mL

Anti-MBP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-MBP Rabbit Monoclonal Antibody
MBS1750153-03 5x 0.1 mL

Anti-MBP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
FAM80A antibody - middle region
MBS3212341-01 0.1 mL

FAM80A antibody - middle region

Sign In for Pricing
View Details
FAM80A antibody - middle region
MBS3212341-02 5x 0.1 mL

FAM80A antibody - middle region

Sign In for Pricing
View Details
Mouse Monoclonal IFN-alpha 1 Antibody (2-48) [Alexa Fluor 750]
NBP3-08231AF750 100 µL

Mouse Monoclonal IFN-alpha 1 Antibody (2-48) [Alexa Fluor 750]

Sign In for Pricing
View Details