Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Endoplasmic reticulum-Golgi intermediate compartment protein 2 (ERGIC2)

This Recombinant Macaca fascicularis Endoplasmic reticulum-Golgi intermediate compartment protein 2 (ERGIC2) spans the amino acid sequence from region 1-377.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 2

UniProt

Q4R5C3

Expression Region

1-377

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRLNRKKTLSLVKELDAFPKVPESYVETSASGGTVSLIAFTTMALLTIMEFSVYQDTWM KYEYEVDKDFSSKLRINIDITVAMKCQYVGADVLDLAETMVASADGLVYEPAVFDLSPQQ KEWQRMLQLTQSRLQEEHSLQDVIFKSAFKSASTALPPREDDSSQSPDACRIHGHLYVNK VAGNFHITVGKAIPHPRGHAHLAALVNHESYNFSHRIDHLSFGELVPAIINPLDGTEKIA IDHNQMFQYFITVVPTKLHTYKISADTHQFSVTERERIINHAAGSHGVSGIFMKYDLSSL MVTVTEEHMPFWQFFVRLCGIVGGIFSTTGMLHGIGKFIVEIICCRFRLGSYKPVNSVPF EDGHTDNHLPLLENNTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JAK3 (phospho Tyr785) Antibody
A1080-01 50 μL

JAK3 (phospho Tyr785) Antibody

Sign In for Pricing
View Details
JAK3 (phospho Tyr785) Antibody
A1080-02 100 µL

JAK3 (phospho Tyr785) Antibody

Sign In for Pricing
View Details
PPP2R4 sgRNA CRISPR Lentivector (Human) (Target 3)
K1708304 1.0 µg DNA

PPP2R4 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
ALPP Antibody
E51A06480 100 µL

ALPP Antibody

Sign In for Pricing
View Details
SLC1A1 ORF Vector (Human) (pORF)
ORF009581 1.0 µg DNA

SLC1A1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Ccdc73 Mouse qPCR Primer Pair (NM_177600)
MP202756 200 Reactions

Ccdc73 Mouse qPCR Primer Pair (NM_177600)

Sign In for Pricing
View Details