Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Endoplasmic reticulum-Golgi intermediate compartment protein 2 (ERGIC2)

This Recombinant Macaca fascicularis Endoplasmic reticulum-Golgi intermediate compartment protein 2 (ERGIC2) spans the amino acid sequence from region 1-377.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 2

UniProt

Q4R5C3

Expression Region

1-377

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRLNRKKTLSLVKELDAFPKVPESYVETSASGGTVSLIAFTTMALLTIMEFSVYQDTWM KYEYEVDKDFSSKLRINIDITVAMKCQYVGADVLDLAETMVASADGLVYEPAVFDLSPQQ KEWQRMLQLTQSRLQEEHSLQDVIFKSAFKSASTALPPREDDSSQSPDACRIHGHLYVNK VAGNFHITVGKAIPHPRGHAHLAALVNHESYNFSHRIDHLSFGELVPAIINPLDGTEKIA IDHNQMFQYFITVVPTKLHTYKISADTHQFSVTERERIINHAAGSHGVSGIFMKYDLSSL MVTVTEEHMPFWQFFVRLCGIVGGIFSTTGMLHGIGKFIVEIICCRFRLGSYKPVNSVPF EDGHTDNHLPLLENNTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Constitutive Androstane Receptor / CAR (NR1I3) Antibody
abx235837 100 µg

Constitutive Androstane Receptor / CAR (NR1I3) Antibody

Sign In for Pricing
View Details
AHA1 Rabbit Monoclonal Antibody
AMRe01621-01 50 µL

AHA1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
AHA1 Rabbit Monoclonal Antibody
AMRe01621-02 100 µL

AHA1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
AHA1 Rabbit Monoclonal Antibody
AMRe01621-03 200 µL

AHA1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CHRNA6 Antibody
orb1255818 100 µL

CHRNA6 Antibody

Sign In for Pricing
View Details
CDT1A Antibody
orb785998 2 mg

CDT1A Antibody

Sign In for Pricing
View Details