Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Endoplasmic reticulum-Golgi intermediate compartment protein 2 (Ergic2)

This Recombinant Mouse Endoplasmic reticulum-Golgi intermediate compartment protein 2 (Ergic2) spans the amino acid sequence from region 1-377.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 2

UniProt

Q9CR89

Expression Region

1-377

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRLNRRKTLSLVKELDAFPKVPDSYVETSASGGTVSLIAFTTMALLTIMEFSVYQDTWM KYEYEVDKDFSSKLRINIDITVAMKCHYVGADVLDLAETMVASADGLAYEPALFDLSPQQ REWQRMLQLIQSRLQEEHSLQDVIFKSAFKSASTALPPREDDSSLTPDACRIHGHLYVNK VAGNFHITVGKAIPHPRGHAHLAALVNHDSYNFSHRIDHLSFGELVPGIINPLDGTEKIA VDHNQMFQYFITVVPTKLHTYKISADTHQFSVTERERIINHAAGSHGVSGIFMKYDLSSL MVTVTEEHMPFWQFFVRLCGIIGGIFSTTGMLHGIGKFIVEIICCRFRLGSYKPVRSVPF ADGHTDNHLPLLENNTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PTGS2/COX2/PGHS-2 Protein (His Tag)
PKSH030929 50 µg

Recombinant Human PTGS2/COX2/PGHS-2 Protein (His Tag)

Sign In for Pricing
View Details
CF®640R Picolyl Azide
#92190 1x 500 µg

CF®640R Picolyl Azide

Sign In for Pricing
View Details
GTF3C4 Mouse Monoclonal Antibody [Clone ID: OTI3D4]
CF812626 100 µg

GTF3C4 Mouse Monoclonal Antibody [Clone ID: OTI3D4]

Sign In for Pricing
View Details
Pfdn6 (NM_010385) Mouse Tagged ORF Clone
MG200682 10 µg

Pfdn6 (NM_010385) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Angiopoietin 2 Recombinant Rabbit monoclonal Antibody
HA750436 100 µL

Angiopoietin 2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse TNFR1/TNFRSF1A Protein
PKSM041215-01 10 µg

Recombinant Mouse TNFR1/TNFRSF1A Protein

Sign In for Pricing
View Details