Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus UPF0754 membrane protein SH1116 (SH1116)

This Recombinant Staphylococcus haemolyticus UPF0754 membrane protein SH1116 (SH1116) spans the amino acid sequence from region 1-378.

Product Specifications

Product Name Alternative

UPF0754 membrane protein SH1116

UniProt

Q4L7F0

Expression Region

1-378

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQAFLVILFMVVVGAVIGGVTNVIAIRMLFHPFKPYYIFKMRIPFTPGLIPKRREEIATK IGQVIEEHLITESVILQKLNEPNTREAINDLVIKQLSKLKSDDATIRKFANQFDFDLDLD DLINNKLDKTIINKLNNYYYDKQATSINEILPADVITMVDEKLDQAGDLIRERARNYLSS DKGARDIYDMLDTFFAEKGKIVGLLQMFMTKESIAERVQHELIRLTRHPKAKVIIDKVIR DEYETLKSQPLSHVVKEEQFTNISESLVHLVITNLQLNEKMDTPISKLTPKLVDQIQVGV ANTITDLIIKQASNHLSTIMTKINLRQMVENQINTFDLDYIERLIIEIANKELKLIMSLG FILGGIIGFFQGIVAIFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-100 1x 100 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF740 conjugate, 0.1mg/mL
BNC740189-100 1x 100 µL

CD74 (BU45), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
BNC740226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF647 conjugate, 0.1mg/mL
BNC470345-100 1x 100 µL

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF594 conjugate, 0.1mg/mL
BNC940039-100 1x 100 µL

CD34 (ICO-115), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details