Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis subsp. konkukian UPF0754 membrane protein BT9727_0767 (BT9727_0767)

This Recombinant Bacillus thuringiensis subsp. konkukian UPF0754 membrane protein BT9727_0767 (BT9727_0767) spans the amino acid sequence from region 1-378.

Product Specifications

Product Name Alternative

UPF0754 membrane protein BT9727_0767

UniProt

Q6HMW0

Expression Region

1-378

Origin

Bacillus thuringiensis subsp. konkukian (strain 97-27)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNIWLSMLTTTGLGAIIGGFTNHLAIKMLFRPHRPIYIGKFQVPFTPGLIPKRRDELAVQ LGKMVVEHLLTPEGIGKKLTNEEFQKGLIHWAQVEVDKVITNEQSLRHMLGKWDVAHVEK EATEKIEQVITEKIQAFLEEYYTYTWEQALPHSVHEKIENAIPNVSAFILKRAIHFFESE EGKSRLSKMIDDFFASRGALLNLVGMFLGNVSVVDRVQPEVIKFLGQDGTKQLLTDVLQK EWEKLKGRDVKELETFVEKEMIVSSILSAVKVEETVSKFLNQSVQQVCEPVRETIIEKVV PGVVTKGLKWGTENVESILHNLHLAEIVQQEVSTFSTERLEELVLSITKNELKMITYLGA LLGGMIGIVQGLLLLFLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL
BNC040034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF488A conjugate, 0.1mg/mL
BNC880164-500 1x 500 µL

CD28 (204.12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL
BNC470043-100 1x 100 µL

P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
BNC040009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
BNC040026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), CF640R conjugate, 0.1mg/mL
BNC400531-500 1x 500 µL

VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details