Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Mitochondrial inner membrane magnesium transporter MFM1 (MFM1)

This Recombinant Saccharomyces cerevisiae Mitochondrial inner membrane magnesium transporter MFM1 (MFM1) spans the amino acid sequence from region 36-413.

Product Specifications

Product Name Alternative

Mitochondrial inner membrane magnesium transporter MFM1, MRS2 function modulating factor 1

UniProt

Q02783

Expression Region

36-413

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FSRQMPKVDPDNTAAMLLQKNLIQRNNMLYGYGSGTIRCTLLDSTGRAKSPLVEIKREDL VSKHGLLPRDLRKIEKSRKNDLVPSLLVRENSILISLLTVKALIKPDMVIIFDSAGSGIT LNSEAHKDFINDMKLRLKNQETSELNSDPLPYEFRALETIFISALSNLTSEMKVLLTICK GVLQDLEFSITRDKLRFLLGQNKKLSSFNKKAVLVKDMLDDLLEQDDMLCDMYLTDKKAG KIRVQDDHTEIEMLLETYHNYVDEIVQKSESAISDVKTTEEIINIILDSNRNELMLLGIR YAIGMLSLGGALFLGSIYGMNLESFIEESNYAYLTVTILGLISTVWLYAKGIRHLHKLQR MTLLSKIKTDSVHELLKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-500 1x 500 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF740 conjugate, 0.1mg/mL
BNC740160-500 1x 500 µL

CD20 (B9E9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
BNC881081-500 1x 500 µL

CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL
BNC880178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bax (2D2), CF640R conjugate, 0.1mg/mL
BNC400004-500 1x 500 µL

Bax (2D2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD22 / BL-CAM (B-Cell Marker) (RFB4), CF740 conjugate, 0.1mg/mL
BNC741594-500 1x 500 µL

CD22 / BL-CAM (B-Cell Marker) (RFB4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details