Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cercopithecine herpesvirus 1 Envelope glycoprotein D (gD)

This Recombinant Cercopithecine herpesvirus 1 Envelope glycoprotein D (gD) spans the amino acid sequence from region 18-395.

Product Specifications

Product Name Alternative

Envelope glycoprotein D, gD

UniProt

P36342

Expression Region

18-395

Origin

Cercopithecine herpesvirus 1 (CeHV-1) (Simian herpes B virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RVPAGEGEYVPVERSLTRVNPGRFRGAHLPPLEQKTDPPDVRRVYHVQPFVENPFQTPSV PVAVYYAVLERACRSVLLWAPTEAVQVVRGAPEATRSDARYNLTVAWYRTSDDCAIPILV MEYAECQYDKPLGACPVRNLPRWSFYDSFSATGDDDLGLLMHAPAFETAGTYVRLVKVNG WVEVTQFIFEHRGKGPCRYTLPLRILPAACLRAPVFEQGVTVDAIGMLPRFIPENQRIVA VYSLQAAGWHGPKAPFTSTLLPPEVVETANVTRPELAPEERGTSRTPGDEPAPAVAAQLP PNWHVPEASDVTIQGPAPAPSGHTGAVVGALAGAGLAAGVVVLAVYLVRRRGRAAGKHVR LPELLEEAHGPARRGAPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

dsGreen for Real-Time PCR, 100×, 1.5 mL
51010 1.5 mL

dsGreen for Real-Time PCR, 100×, 1.5 mL

Sign In for Pricing
View Details
Treponema Pallidum (Syphilis) IgM ELISA
GWB-BQK232 96 Well Plate

Treponema Pallidum (Syphilis) IgM ELISA

Sign In for Pricing
View Details
Rabbit CLEC4E (C-Type Lectin Domain Family 4 Member E) ELISA Kit
MBS2512752-01 24 Tests

Rabbit CLEC4E (C-Type Lectin Domain Family 4 Member E) ELISA Kit

Sign In for Pricing
View Details
Rabbit CLEC4E (C-Type Lectin Domain Family 4 Member E) ELISA Kit
MBS2512752-02 48 Tests

Rabbit CLEC4E (C-Type Lectin Domain Family 4 Member E) ELISA Kit

Sign In for Pricing
View Details
Rabbit CLEC4E (C-Type Lectin Domain Family 4 Member E) ELISA Kit
MBS2512752-03 96 Tests

Rabbit CLEC4E (C-Type Lectin Domain Family 4 Member E) ELISA Kit

Sign In for Pricing
View Details
Rabbit CLEC4E (C-Type Lectin Domain Family 4 Member E) ELISA Kit
MBS2512752-04 5x 96 Tests

Rabbit CLEC4E (C-Type Lectin Domain Family 4 Member E) ELISA Kit

Sign In for Pricing
View Details