Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SUN domain-containing protein 5 (SUN5)

This Recombinant Human SUN domain-containing protein 5 (SUN5) spans the amino acid sequence from region 1-379.

Product Specifications

Product Name Alternative

SUN domain-containing protein 5, Sad1 and UNC84 domain-containing protein 5, Sperm-associated antigen 4-like protein, Testis and spermatogenesis-related gene 4 protein

UniProt

Q8TC36

Expression Region

1-379

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPRSSRSPGDPGALLEDVAHNPRPRRIAQRGRNTSRMAEDTSPNMNDNILLPVRNNDQAL GLTQCMLGCVSWFTCFACSLRTQAQQVLFNTCRCKLLCQKLMEKTGILLLCAFGFWMFSI HLPSKMKVWQDDSINGPLQSLRLYQEKVRHHSGEIQDLRGSMNQLIAKLQEMEAMSDEQK MAQKIMKMIHGDYIEKPDFALKSIGASIDFEHTSVTYNHEKAHSYWNWIQLWNYAQPPDV ILEPNVTPGNCWAFEGDRGQVTIQLAQKVYLSNLTLQHIPKTISLSGSLDTAPKDFVIYG MEGSPKEEVFLGAFQFQPENIIQMFPLQNQPARAFSAVKVKISSNWGNPGFTCLYRVRVH GSVAPPREQPHQNPYPKRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP43 Antibody
KC-2226-01 50 μL

CEP43 Antibody

Sign In for Pricing
View Details
CEP43 Antibody
KC-2226-02 100 µL

CEP43 Antibody

Sign In for Pricing
View Details
CEP43 Antibody
KC-2226-03 1 mL

CEP43 Antibody

Sign In for Pricing
View Details
Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1366), CF555 conjugate, 0.1mg/mL
BNC551366-100 1x 100 µL

Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1366), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAP126 (SPAG5) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F2]
TA810449BM 100 µL

MAP126 (SPAG5) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F2]

Sign In for Pricing
View Details
Prxl2c Mouse Gene Knockout Kit (CRISPR)
KN500580 1 Kit

Prxl2c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details