Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Choristoneura fumiferana nuclear polyhedrosis virus Occlusion-derived virus envelope protein E56 (ODVP6E)

This Recombinant Choristoneura fumiferana nuclear polyhedrosis virus Occlusion-derived virus envelope protein E56 (ODVP6E) spans the amino acid sequence from region 1-379.

Product Specifications

Product Name Alternative

Occlusion-derived virus envelope protein E56, ODV-E56, ODVP-6E

UniProt

P41718

Expression Region

1-379

Origin

Choristoneura fumiferana nuclear polyhedrosis virus (CfMNPV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTFFTNLRRVNKVYPNQATFLTDNTRLLTTTPAGFTNVLRAPSTRNLGNGRFEPGYNLS NNQFVSAGDINRITRGNDVPRIRNVFQGISDPQIGSLNQLRRADNVPDAGLHVKRTRSDA VKQNFPETNVRSADGVDRALQQNPRLNTYLQGAKTAGVGVLLAGGAYLTFSAATLVQDII QALNNTGGSYYVRGADGGDTADACLLLSRTCQRDPNMNTSDVVICNHDPLIADTAQLQAI CSGFNYQQEQTVCRQSDPAADPDSPQFVDVSDLLPGQTIMCIEPYNLGDLIGDLGLDHLL GEDGLVGKSSNSSDSVSNKLMPLIWLIGAVLFLGLIIYLIYRFVIKGGAGAAGAARAPPV IVLPPPPTQQTYNSTKQQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-500 1x 500 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
BNC880204-500 1x 500 µL

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
BNC040304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF488A conjugate, 0.1mg/mL
BNC880645-500 1x 500 µL

FOXP3 (3G3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF740 conjugate, 0.1mg/mL
BNC740645-100 1x 100 µL

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10/844), CF647 conjugate, 0.1mg/mL
BNC470844-100 1x 100 µL

Cytokeratin 10 (KRT10/844), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details