Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lysinibacillus sphaericus UPF0754 membrane protein Bsph_0374 (Bsph_0374)

This Recombinant Lysinibacillus sphaericus UPF0754 membrane protein Bsph_0374 (Bsph_0374) spans the amino acid sequence from region 1-380.

Product Specifications

Product Name Alternative

UPF0754 membrane protein Bsph_0374

UniProt

B1HVI2

Expression Region

1-380

Origin

Lysinibacillus sphaericus (strain C3-41)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNFIVTLLFMAIIGAAIGGVTNHLAIKMLFRPHNAIYIKNWRVPFTPGLIPKRRDELAK QLGLTVVNYLLTPETFRKKFFSKDIQEKVEQFVQTKVEETIFTNDKTIQDWLNIAGFSHM PATIEQKVEAIVEGQFASVKNTLSTKSIRTLLSSDMQDTLDAKIPVAVSHILEKGEDYFL SPEGEMTIKAMIDDFLSSKGSFGGMINMFLGDSSSLVGKVQRELVKFLQAPGTSTLLTKI FTQEWEKLKDRPAMDFLQDMQFDPILSKLQMYVKEQLAVAERLNQPISYYWPEGNEWMKN SVIPQAIDKAFVKAEEKLEDVLKRLNLQEVVREQVDSFPVEKLEELVLGISKREFKMITV LGAVLGGLIGIVQGLIVNFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WT1 (Wilm's Tumor 1) (WT1/857), CF640R conjugate, 0.1mg/mL
BNC400857-500 1x 500 µL

WT1 (Wilm's Tumor 1) (WT1/857), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (SOX10/1074), CF647 conjugate, 0.1mg/mL
BNC471017-100 1x 100 µL

SOX10 (SOX10/1074), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (C-04), CF594 conjugate, 0.1mg/mL
BNC940041-500 1x 500 µL

Cytokeratin 18 (C-04), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD1 / PDCD1 / CD279 (PDCD1/922), CF594 conjugate, 0.1mg/mL
BNC940922-100 1x 100 µL

PD1 / PDCD1 / CD279 (PDCD1/922), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
BNC740270-500 1x 500 µL

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (r1415-1), CF488A conjugate, 0.1mg/mL
BNC881797-100 1x 100 µL

Histone H1 (Nuclear Marker) (r1415-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details