Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Magnesium transporter MRS2-8 (MRS2-8)

This Recombinant Arabidopsis thaliana Magnesium transporter MRS2-8 (MRS2-8) spans the amino acid sequence from region 1-380.

Product Specifications

Product Name Alternative

Magnesium transporter MRS2-8, Magnesium Transporter 8, AtMGT8

UniProt

P0CZ21

Expression Region

1-380

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPNEELVPVKRITPQSSWSWISIDATGKKTVLDVDKYVIMHRVQIHARDLRILDPNLFY PSAILGRERAIVLNLEHIKAIITAKEVLIQDSSDENLIPTLEEFQTRLSVGNKAHGGQLD GDVVEEDESAFEFRALEVALEAICSFLAARTIELEKSAYPALDELTLKLTSRNLLRVCKL KSSMTRLTAQVQKIKDELEQLLEDDEDMAELYLSRKLAGASSPAIDSGEHINWYPTSPTI GAKISRAKSHLVRSATVRGDDKNDVEEVEMLLEAHFMQIDRTLNKLTELREYVDETEDFL NIQLDSSRNQLIKFEIILTAGSICVSVYSVVVGILGMNIPFPWNIKKHMFKWVVSGTATV CAILFVTIMSFARYKKLFGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-100 1x 100 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
BNC040158-100 1x 100 µL

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL
BNC941050-500 1x 500 µL

CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
BNC940253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-500 1x 500 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF488A conjugate, 0.1mg/mL
BNC880175-100 1x 100 µL

CD46 (122.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details