Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein Rv3691 (Rv3691)

This Recombinant Uncharacterized membrane protein Rv3691 (Rv3691) spans the amino acid sequence from region 1-381.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein Rv3691

UniProt

O69659

Expression Region

1-381

Origin

Mycobacterium tuberculosis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGAGPVIPTRLATVRRRRPWRGVLLTLAAVAVVASIGTYLTAPRPGGAMAPASTSSTGGH ALATLLGNHGVEVVVADSIADVEAAARPDSLLLVAQTQYLVDNALLDRLAKAPGDLLLVA PTSRTRTALTPQLRIAAASPFNSQPNCTLREANRAGSVQWGPSDTYQATGDLVLTSCYGG ALVRFRAEGRTITVVGSSNFMTNGGLLPAGNAALAMNLAGNRPRLVWYAPDHIEGEMSSP SSLSDLIPENVHWTIWQLWLVVLLVALWKGRRIGPLVAEELPVVIRASETVEGRGRLYRS RRARDRAADALRTATLQRLRPRLGVGAGAPAPAVVTTIAQRSKADPPFVAYHLFGPAPAT DNDLLQLARALDDIERQVTHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatitis A virus cellular receptor 2 Polyclonal Conjugated Antibody
orb1617986 100 µL

Hepatitis A virus cellular receptor 2 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
TGF b 3 Mouse
PT-A05471-01 2 µg

TGF b 3 Mouse

Sign In for Pricing
View Details
TGF b 3 Mouse
PT-A05471-02 10 µg

TGF b 3 Mouse

Sign In for Pricing
View Details
TGF b 3 Mouse
PT-A05471-03 100 µg

TGF b 3 Mouse

Sign In for Pricing
View Details
INTS1 Antibody
MBS9401855-01 0.1 mL

INTS1 Antibody

Sign In for Pricing
View Details
INTS1 Antibody
MBS9401855-02 5x 0.1 mL

INTS1 Antibody

Sign In for Pricing
View Details