Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein Rv3691 (Rv3691)

This Recombinant Uncharacterized membrane protein Rv3691 (Rv3691) spans the amino acid sequence from region 1-381.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein Rv3691

UniProt

O69659

Expression Region

1-381

Origin

Mycobacterium tuberculosis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGAGPVIPTRLATVRRRRPWRGVLLTLAAVAVVASIGTYLTAPRPGGAMAPASTSSTGGH ALATLLGNHGVEVVVADSIADVEAAARPDSLLLVAQTQYLVDNALLDRLAKAPGDLLLVA PTSRTRTALTPQLRIAAASPFNSQPNCTLREANRAGSVQWGPSDTYQATGDLVLTSCYGG ALVRFRAEGRTITVVGSSNFMTNGGLLPAGNAALAMNLAGNRPRLVWYAPDHIEGEMSSP SSLSDLIPENVHWTIWQLWLVVLLVALWKGRRIGPLVAEELPVVIRASETVEGRGRLYRS RRARDRAADALRTATLQRLRPRLGVGAGAPAPAVVTTIAQRSKADPPFVAYHLFGPAPAT DNDLLQLARALDDIERQVTHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nxf3 Mouse shRNA Lentiviral Particle (Locus ID 245610)
TL516961V 500 µL Each

Nxf3 Mouse shRNA Lentiviral Particle (Locus ID 245610)

Sign In for Pricing
View Details
BtuD Antibody
orb810883 2 mg

BtuD Antibody

Sign In for Pricing
View Details
PIB5PA (INPP5J) (NM_001002837) Human Over-expression Lysate
LS027124-20ug 20 µg

PIB5PA (INPP5J) (NM_001002837) Human Over-expression Lysate

Sign In for Pricing
View Details
Cd177 Mouse Pre-designed siRNA Set A
HY-RS17501 1 Set

Cd177 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Hsa-miR-6749-5p mimic
HY-R02055-01 5 nmol

Hsa-miR-6749-5p mimic

Sign In for Pricing
View Details
Hsa-miR-6749-5p mimic
HY-R02055-02 20 nmol

Hsa-miR-6749-5p mimic

Sign In for Pricing
View Details