Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Metallophosphoesterase 1 (mppe1)

This Recombinant Danio rerio Metallophosphoesterase 1 (mppe1) spans the amino acid sequence from region 1-381.

Product Specifications

Product Name Alternative

Metallophosphoesterase 1, EC= 3.1.-.-, Post-GPI attachment to proteins factor 5

UniProt

Q566Y9

Expression Region

1-381

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLVFGSSCRLAVTLIFAFVSVFVFCEYVIYYLVILRCSWPLLEIEDSHSPLRALFLSDT HLLGAIRGHWLDKLRREWQMERAFQTSMWLLNPEVVFILGDVFDEGKWSTSQDWEDDVRR FKRIFRHPVDTKLVVLVGNHDIGFHHEMTKQKLERFEQVFNVTSARILTIKGVNFLLVNS VALHGDHCPICQHVEEELQKLSHALNCSIQGAQHNGQCKNAARFAPAAPVLLQHYPLYRV SDAMCTGVDTAPLDEQYLLFQERYDVISKNASKKLLWWFKPRLILSGHTHNGCEVLHEKL YPEISVPSFSWRNRNNPSFVLGTFSQSEFQLSKCFLPEERTVLVVYCSSCLIIALITLIH LKMFRNSLQFTNNLIGKHKTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL
BNC040861-500 1x 500 µL

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
BNC680679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL
BNC400525-500 1x 500 µL

CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
BNC400017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-100 1x 100 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL
BNC740266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details