Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat E3 ubiquitin-protein ligase RNF133 (Rnf133)

This Recombinant Rat E3 ubiquitin-protein ligase RNF133 (Rnf133) spans the amino acid sequence from region 1-381.

Product Specifications

Product Name Alternative

E3 ubiquitin-protein ligase RNF133, EC= 6.3.2.-, RING finger protein 133

UniProt

Q6AY01

Expression Region

1-381

Origin

Rattus norvegicus (Rat)

Field of Research

Molecular Biology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLQTGPWQTSAPSFWLLKFSFIWLVSQNCCTASAVWTAYMNISFHVGNRMLSELGETG VFGRSSILKRVAGVVVPPEGKIQNACDPNTSFILPRNKEPWIALIERGGCAFTQKIKVAS ENGARGVIIYNFPGTGNQVFPMSHQAFEDIVVVMIGNVKGMEILHLIRKGVHVTVMVEVG RKHVIWLNHYFVSFMIVTTATLAYFTFYHIRRLWVARIEDRRWKRLTRELKKAFGQLQVR ILKEGDEEVSPNADSCVICFEAYKPNEIVRILTCKHFFHKNCIDPWILAHGTCPMCKCDI LKALGIQMDIEDGSDSLQVLMSNELPGTFSAMEEELNNELPPARTSSKVTHVQEHPTSVN VGSQPPEAEETGHPSFGQHDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL
BNC401081-500 1x 500 µL

CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL
BNC941050-500 1x 500 µL

CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
BNC400977-100 1x 100 µL

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF594 conjugate, 0.1mg/mL
BNC940176-100 1x 100 µL

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF488A conjugate, 0.1mg/mL
BNC880152-100 1x 100 µL

CD11c (HC1/1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF647 conjugate, 0.1mg/mL
BNC471035-500 1x 500 µL

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details