Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Protein COS8 (COS8)

This Recombinant Saccharomyces cerevisiae Protein COS8 (COS8) spans the amino acid sequence from region 1-381.

Product Specifications

Product Name Alternative

Protein COS8

UniProt

P38723

Expression Region

1-381

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKENEVKDEKSVDVLSFKQLEFQKTVLPQDVFRNELTWFCYEIYKSLAFRIWMLLWLPLS VWWKLSSNWIHPLIVSLLVLFLGPFFVLVICGLSRKRSLSKQLIQFCKEITEDTPSSDPH DWEVVAANLNSYFYENKTWNTKYFFFNAMSCQKAFKTTLLEPFSLKKDESAKVKSFKDSV PYIEEALQVYAAGFDKEWKLFNTEKEESPFDLEDIQLPKEAYRFKLTWILKRIFNLRCLP LFLYYFLIVYTSGNADLISRFLFPVVMFFIMTRDFQNMRMIVLSVKMEHKMQFLSTIINE QESGANGWDEIAKKMNRYLFEKKVWNNEEFFYDGLDCEWFFRRFFYRLLSLKKPMWFASL NVELWPYIKEAQSARNEKPLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (BU63), CF647 conjugate, 0.1mg/mL
BNC470193-100 1x 100 µL

CD86 (BU63), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF647 conjugate, 0.1mg/mL
BNC470338-500 1x 500 µL

P53 (PAb122), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
BNC680676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-500 1x 500 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), CF488A conjugate, 0.1mg/mL
BNC882558-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF488A conjugate, 0.1mg/mL
BNC881884-100 1x 100 µL

Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details