Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Sad1-interacting factor 2 (sif2)

This Recombinant Schizosaccharomyces pombe Sad1-interacting factor 2 (sif2) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Sad1-interacting factor 2, Sporulation protein sif2

UniProt

O74446

Expression Region

1-382

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNRIGPQRSTKTAAKLRLLPSTEEFDDFRRQDTGREVYSQIPQIEGSTAKRDAEHLGKR HREFLPRVTAYCTCDTFRVDLLFKFFQSRRSSHKTRPKQFDECIYSPYSYNNEETTDLLP DTLESSRGTLNRESSQESLQSIFEESGLDRNQPLFREVFCFTYGVVVLWGYTIDEEHRFL RELGRFEIEKLKIEDMEVEEFNYYITTLYQPRIFNDFIALRDASNYMIRLSISHAIAQSV KISLFEELVNETIDATKDTPQMIAETGRVNLKREEIMMAVGQLFILRININLQGSVLDSP ELMWTEPQLEPIYTAARSYLEINQRVALLNQRVEVIGDLLSMLKEQITHTHDESLEWIVV ILMGLLVLIALFSIVVDWKLFQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Heptanoyl Chloride
TRC-H281235-25G 25 g

Heptanoyl Chloride

Sign In for Pricing
View Details
Human PCOLE2 (PCOLCE2) activation kit by CRISPRa
GA108906 1 Kit

Human PCOLE2 (PCOLCE2) activation kit by CRISPRa

Sign In for Pricing
View Details
MICOS10-NBL1 Mouse Monoclonal Antibody [Clone ID: AT38G8]
AM50052PU-N 100 µL

MICOS10-NBL1 Mouse Monoclonal Antibody [Clone ID: AT38G8]

Sign In for Pricing
View Details
Bcl-2 (BCL2/796), CF594 conjugate, 0.1mg/mL
BNC940796-100 1x 100 µL

Bcl-2 (BCL2/796), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IFNGR2 (NM_005534) Human Over-expression Lysate
LY401697 100 µg

IFNGR2 (NM_005534) Human Over-expression Lysate

Sign In for Pricing
View Details
Thyroglobulin (2H11), Biotin conjugate, 0.1mg/mL
BNCB0023-500 1x 500 µL

Thyroglobulin (2H11), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details