Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Sad1-interacting factor 2 (sif2)

This Recombinant Schizosaccharomyces pombe Sad1-interacting factor 2 (sif2) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Sad1-interacting factor 2, Sporulation protein sif2

UniProt

O74446

Expression Region

1-382

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNRIGPQRSTKTAAKLRLLPSTEEFDDFRRQDTGREVYSQIPQIEGSTAKRDAEHLGKR HREFLPRVTAYCTCDTFRVDLLFKFFQSRRSSHKTRPKQFDECIYSPYSYNNEETTDLLP DTLESSRGTLNRESSQESLQSIFEESGLDRNQPLFREVFCFTYGVVVLWGYTIDEEHRFL RELGRFEIEKLKIEDMEVEEFNYYITTLYQPRIFNDFIALRDASNYMIRLSISHAIAQSV KISLFEELVNETIDATKDTPQMIAETGRVNLKREEIMMAVGQLFILRININLQGSVLDSP ELMWTEPQLEPIYTAARSYLEINQRVALLNQRVEVIGDLLSMLKEQITHTHDESLEWIVV ILMGLLVLIALFSIVVDWKLFQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAE1 (NM_016402) Human Over-expression Lysate
LY429497 100 µg

SAE1 (NM_016402) Human Over-expression Lysate

Sign In for Pricing
View Details
UNC119 binding protein C5orf30 (C5orf30) (NM_033211) Human Over-expression Lysate
LC403234 20 µg

UNC119 binding protein C5orf30 (C5orf30) (NM_033211) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS503923 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
HLA-C Antibody
KC-32564-01 50 μL

HLA-C Antibody

Sign In for Pricing
View Details
HLA-C Antibody
KC-32564-02 100 µL

HLA-C Antibody

Sign In for Pricing
View Details
HLA-C Antibody
KC-32564-03 1 mL

HLA-C Antibody

Sign In for Pricing
View Details