Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse E3 ubiquitin-protein ligase RNF133 (Rnf133)

This Recombinant Mouse E3 ubiquitin-protein ligase RNF133 (Rnf133) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

E3 ubiquitin-protein ligase RNF133, EC= 6.3.2.-, Goliath-related E3 ubiquitin-protein ligase 2, RING finger protein 133

UniProt

Q14B02

Expression Region

1-382

Origin

Mus musculus (Mouse)

Field of Research

Molecular Biology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLQTSTWQNQAPSFWLLRFSFIWLVSQKCCTASAVWTAYMNISFHVGNRMLSELGETG VFGRSSILKRVAGVVVPPEGKIQNACDPNTTFILPRNKEPWIALIERGGCAFTQKIKVAS EHGARGVIIYNFPGTGNQVFPMSHQAFEDIVVVMIGNIKGMEILHLIRKGVHVTVMVEVG RKHVIWLNHYFVSFMIVTTATLAYFTFYHIRRLWVARIENRRWKRLTRELKKAFGQLQVR VLKEGDEEVNPNADSCVICFEAYKPNEIVRILTCKHFFHKNCIDPWILAHGTCPMCKCDI LKALGIQMDIEDGTDSLQVLMSNELPGTLSPVEEETNYELPPARTSSKVTHVQEHPTSSA NAGSQPPEAEETSHPSHGQQVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
BNC940225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL
BNC940978-500 1x 500 µL

CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF640R conjugate, 0.1mg/mL
BNC400039-100 1x 100 µL

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), 1mg/mL
BNUM0861-50 1x 50 µL

HSP27 (G3.1), 1mg/mL

Sign In for Pricing
View Details
CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2474), CF405S conjugate, 0.1mg/mL
BNC042474-500 1x 500 µL

CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2474), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calcineurin B / PPP3R1 (CALNB/2342), CF594 conjugate, 0.1mg/mL
BNC942342-500 1x 500 µL

Calcineurin B / PPP3R1 (CALNB/2342), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details