Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3)

This Recombinant Macaca fascicularis Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 3

UniProt

Q4R8X1

Expression Region

1-382

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYV DKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGTPVSSEAE RHELGKVEVTVFGPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGAFKNPDTIEQ CRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNIN MTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFS VTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGL IDSLIYHSARAIQKKIDLGKTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
BNC470630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SCF (Stem Cell Factor) ELISA Kit
E-EL-H1299-01 24 Tests

Human SCF (Stem Cell Factor) ELISA Kit

Sign In for Pricing
View Details
Human SCF (Stem Cell Factor) ELISA Kit
E-EL-H1299-02 48 Tests

Human SCF (Stem Cell Factor) ELISA Kit

Sign In for Pricing
View Details
Human SCF (Stem Cell Factor) ELISA Kit
E-EL-H1299-03 96 Tests

Human SCF (Stem Cell Factor) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Pancreas
CS623583 5x 5 µm

Frozen Tissue Sections, Pancreas

Sign In for Pricing
View Details
(+)-Alpha-Cyperone
TRC-C989595-10MG 10 mg

(+)-Alpha-Cyperone

Sign In for Pricing
View Details