Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3)

This Recombinant Macaca fascicularis Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 3

UniProt

Q4R8X1

Expression Region

1-382

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYV DKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGTPVSSEAE RHELGKVEVTVFGPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGAFKNPDTIEQ CRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNIN MTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFS VTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGL IDSLIYHSARAIQKKIDLGKTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aldo-keto Reductase Family 1 Member C2 / DD2 (CPTC-AKR1C2-1), CF568 conjugate, 0.1mg/mL
BNC682255-500 1x 500 µL

Aldo-keto Reductase Family 1 Member C2 / DD2 (CPTC-AKR1C2-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Liver Carboxylesterase 1 (CES1) (NM_001266) Human Recombinant Protein
TP320398 20 µg

Liver Carboxylesterase 1 (CES1) (NM_001266) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Aff2 activation kit by CRISPRa
GA201456 1 Kit

Mouse Aff2 activation kit by CRISPRa

Sign In for Pricing
View Details
(2Z)-2-Hexylidenecyclopentanone
TRC-H396553-1G 1 g

(2Z)-2-Hexylidenecyclopentanone

Sign In for Pricing
View Details
Mouse Adiponectin (ADP) ELISA Kit
RD-ADP-Mu-01 96 Tests

Mouse Adiponectin (ADP) ELISA Kit

Sign In for Pricing
View Details
Mouse Adiponectin (ADP) ELISA Kit
RD-ADP-Mu-02 48 Tests

Mouse Adiponectin (ADP) ELISA Kit

Sign In for Pricing
View Details