Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3)

This Recombinant Macaca fascicularis Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 3

UniProt

Q4R8X1

Expression Region

1-382

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYV DKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGTPVSSEAE RHELGKVEVTVFGPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGAFKNPDTIEQ CRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNIN MTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFS VTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGL IDSLIYHSARAIQKKIDLGKTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FARS2 Rabbit Polyclonal Antibody
orb78426 100 µg

FARS2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ACADS Peptide
MBS3236517-01 0.1 mg

ACADS Peptide

Sign In for Pricing
View Details
ACADS Peptide
MBS3236517-02 5x 0.1 mg

ACADS Peptide

Sign In for Pricing
View Details
SIRT3 Rabbit pAb
E45R27278N-50 50 µL

SIRT3 Rabbit pAb

Sign In for Pricing
View Details
Suberoyl bis-hydroxamic acid 50mg
A22581-50 50 mg

Suberoyl bis-hydroxamic acid 50mg

Sign In for Pricing
View Details
MLN4924 5mg
A11260-5 5 mg

MLN4924 5mg

Sign In for Pricing
View Details