Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Kluyveromyces lactis Mitochondrial inner membrane i-AAA protease complex subunit MGR1 (MGR1)

This Recombinant Kluyveromyces lactis Mitochondrial inner membrane i-AAA protease complex subunit MGR1 (MGR1) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Mitochondrial inner membrane i-AAA protease complex subunit MGR1

UniProt

Q6CUZ6

Expression Region

1-382

Origin

Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAIYTSGTQSDNSEPVGNDPKFYTRPSLGLKLWGPLVPSSDNTTGLWSLVAIQTGLGLFL MQRFRKLGKKWVKRDIADFPSLNRFSTTHGDMYMTRHIPVQFGGTHSFNIRVGTRTGFWY SERFRTIRRVTYLLAGTLILSQSMLEVSRLTLLKYDPWVEEAKSVREKQFFNDIVKYYHE GVDSTKFKAKDELSGQSISLNLPEVKQSIAVARAQAQAENLVTKWFGPLDYKPQSFSEFL DKLEYYLNMTDFLNNLRRQKKNDKINSQLVKLEEENKRNRQRIHTLMAHAPARAIRTNQE VQDIYAIRKVLLHHDTESPNDIPLTEIWAIYNPWTNLALDTALSIKFFPSVIFNEDYYEH QKRLKDSEHVTSIENSEDERKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD181 Antibody
MBS5315908-01 0.1 mL

CD181 Antibody

Sign In for Pricing
View Details
CD181 Antibody
MBS5315908-02 5x 0.1 mL

CD181 Antibody

Sign In for Pricing
View Details
POLR2L (DNA-directed RNA Polymerases I, II, and III Subunit RPABC5, RNA Polymerases I, II, and III Subunit ABC5, DNA-directed RNA Polymerase III Subunit L, RNA Polymerase II 7.6kD Subunit, RPB7.6, RPB10 Homolog) (MaxLight 405)
MBS6390158-01 0.1 mL

POLR2L (DNA-directed RNA Polymerases I, II, and III Subunit RPABC5, RNA Polymerases I, II, and III Subunit ABC5, DNA-directed RNA Polymerase III Subunit L, RNA Polymerase II 7.6kD Subunit, RPB7.6, RPB10 Homolog) (MaxLight 405)

Sign In for Pricing
View Details
POLR2L (DNA-directed RNA Polymerases I, II, and III Subunit RPABC5, RNA Polymerases I, II, and III Subunit ABC5, DNA-directed RNA Polymerase III Subunit L, RNA Polymerase II 7.6kD Subunit, RPB7.6, RPB10 Homolog) (MaxLight 405)
MBS6390158-02 5x 0.1 mL

POLR2L (DNA-directed RNA Polymerases I, II, and III Subunit RPABC5, RNA Polymerases I, II, and III Subunit ABC5, DNA-directed RNA Polymerase III Subunit L, RNA Polymerase II 7.6kD Subunit, RPB7.6, RPB10 Homolog) (MaxLight 405)

Sign In for Pricing
View Details
Rabbit anti-AP1-mu-1 Antibody
DL97265A-01 50 µL

Rabbit anti-AP1-mu-1 Antibody

Sign In for Pricing
View Details
Rabbit anti-AP1-mu-1 Antibody
DL97265A-02 100 µL

Rabbit anti-AP1-mu-1 Antibody

Sign In for Pricing
View Details