Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Type II secretion system protein L (xcpY)

This Recombinant Pseudomonas aeruginosa Type II secretion system protein L (xcpY) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Type II secretion system protein L, T2SS protein L, General secretion pathway protein L

UniProt

P25060

Expression Region

1-382

Origin

Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGVSALFLPPASTAGADGELAVWWVQDGECRRAPFAQALAEIRAPWRLYLPVEAVTACA VNLPTQKARWLRQSLPFAVEEQLADDVEQMHLALGPALADGRHRVFAVQRTWLAAWLALA EGAGKAPASLHVDADCLPGEGSCLFWLEERWLLGGSGAVRLACGSEDWPVLRDSCPPPQR AFAAQEVAPLEGVEVQALAGNPHVWLSEQPLGTDLAQAEFAARQQSSQWRRWRPLLGLVG LWLVLQWGFTLVQAWQLQREGDRYAAQSAELYRQLFPEDRKLINLRAQFDQHLADSASSG GEGQLLGLLGQAATVIGGEPTVSVEQLDFSAARGDVALQVRAPGFDVLERLRSRLSESGL AVQLGSASRDGSTVSARLVIGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAI1 Antibody
orb53535-01 50 µg

RAI1 Antibody

Sign In for Pricing
View Details
RAI1 Antibody
orb53535-02 100 µg

RAI1 Antibody

Sign In for Pricing
View Details
RPL7A Rabbit Polyclonal Antibody
TA381069 100 µL

RPL7A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human KIF5B Pre-designed siRNA Set B
SI008192B 1 Each

Human KIF5B Pre-designed siRNA Set B

Sign In for Pricing
View Details
ML 9 hydrochloride
B6300-100 100 mg

ML 9 hydrochloride

Sign In for Pricing
View Details
Human Retinoschisin (RS) CLIA Kit
MBS2710312-01 24 Strip Well

Human Retinoschisin (RS) CLIA Kit

Sign In for Pricing
View Details