Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Probable endoplasmic reticulum-Golgi intermediate compartment protein 3 (ergic3)

This Recombinant Dictyostelium discoideum Probable endoplasmic reticulum-Golgi intermediate compartment protein 3 (ergic3) spans the amino acid sequence from region 1-383.

Product Specifications

Product Name Alternative

Probable endoplasmic reticulum-Golgi intermediate compartment protein 3

UniProt

Q54DW2

Expression Region

1-383

Origin

Dictyostelium discoideum (Slime mold)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLISQLKKFDAYPKTVDDFRVKTYTGAIVSIIGGVFILWLFFSQVTLYFSTDIHHELFVD TTRGEKLKINMDITFHHLPCAYLSLDAMDVSGEHQFDVAHNIFKKRLSPTGQPIIEAPPI REEEINKKESVKDNNDVVGCGSCYGAEDPSKGIGCCNTCEEVRVAYSKKGWGLDPSGIPQ CIREGFTKNLVEQNGEGCQVYGFILVNKVAGNFHFAPGKSFQQHHMHVHDLQPFKDGSFN VSHTINRLSFGNDFPGIKNPLDDVTKTEMVGVGMFQYFVKVVPTIYEGLNGNRIATNQYS VTEHYRLLAKKGEEPSGLPGLFFMYDLSPIMMKVSERGKSFASFLTNVCAIIGGVFTVFG IFDSFIYYSTKNLQKKIDLGKTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF594 conjugate, 0.1mg/mL
BNC940851-100 1x 100 µL

HSP60 (LK1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
BNC880225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL
BNC470994-100 1x 100 µL

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-100 1x 100 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF568 conjugate, 0.1mg/mL
BNC680449-500 1x 500 µL

CD104 (UM-A9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
BNC680676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details