Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3)

This Recombinant Bovine Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) spans the amino acid sequence from region 1-383.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 3

UniProt

Q5EAE0

Expression Region

1-383

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYV DKSRGDKLKININVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKKRLDKDGFPVSSEAE RHELGKVEVKVFDPDSLDPDRCESCYGAEMEDIKCCNSCEDVREAYRRRGWAFKNPDTIE QCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNI NMTHYIRHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQF SVTRHEKVANGLMGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAG LIDSLIYHSARAIQKKIDLGKTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CD45RA Antibody (Leukocyte marker)
V9422-20UG 20 µg

Recombinant CD45RA Antibody (Leukocyte marker)

Sign In for Pricing
View Details
M4A4E Rabbit Polyclonal Antibody
BT-AP11201-01 20 µL

M4A4E Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
M4A4E Rabbit Polyclonal Antibody
BT-AP11201-02 50 µL

M4A4E Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
M4A4E Rabbit Polyclonal Antibody
BT-AP11201-03 100 µL

M4A4E Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
REXO4 rabbit pAb
E28PT7560 100 µL

REXO4 rabbit pAb

Sign In for Pricing
View Details
Rat Monoclonal Slit2 Antibody (710305) [Janelia Fluor 635]
FAB5444JF635 0.1 mL

Rat Monoclonal Slit2 Antibody (710305) [Janelia Fluor 635]

Sign In for Pricing
View Details