Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3)

This Recombinant Bovine Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) spans the amino acid sequence from region 1-383.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 3

UniProt

Q5EAE0

Expression Region

1-383

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYV DKSRGDKLKININVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKKRLDKDGFPVSSEAE RHELGKVEVKVFDPDSLDPDRCESCYGAEMEDIKCCNSCEDVREAYRRRGWAFKNPDTIE QCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNI NMTHYIRHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQF SVTRHEKVANGLMGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAG LIDSLIYHSARAIQKKIDLGKTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC67 (DEUP1) Rabbit Polyclonal Antibody
TA357111 100 µL

CCDC67 (DEUP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TCEB2 Antibody
27-323 100 µL

TCEB2 Antibody

Sign In for Pricing
View Details
ALAS2 Antibody - C-terminal region
ARP41889_P050-25UL 25 µL

ALAS2 Antibody - C-terminal region

Sign In for Pricing
View Details
Recombinant Human Unique Cartilage Matrix-Associated Protein/UCMA
CG76-500ug 500 µg

Recombinant Human Unique Cartilage Matrix-Associated Protein/UCMA

Sign In for Pricing
View Details
RHBDL6 Lentiviral Activation Particles (h2)
sc-404212-LAC-2 200 µL

RHBDL6 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Fbxo16 siRNA Oligos set (Rat)
20311176 3x 5 nmol

Fbxo16 siRNA Oligos set (Rat)

Sign In for Pricing
View Details