Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3)

This Recombinant Bovine Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) spans the amino acid sequence from region 1-383.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 3

UniProt

Q5EAE0

Expression Region

1-383

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYV DKSRGDKLKININVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKKRLDKDGFPVSSEAE RHELGKVEVKVFDPDSLDPDRCESCYGAEMEDIKCCNSCEDVREAYRRRGWAFKNPDTIE QCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNI NMTHYIRHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQF SVTRHEKVANGLMGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAG LIDSLIYHSARAIQKKIDLGKTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IgA Isotype Control Antibody , FITC
E55A07430 50 Tests

Mouse IgA Isotype Control Antibody , FITC

Sign In for Pricing
View Details
Recombinant MPXV B6R antigen
NBP0262 1 mg

Recombinant MPXV B6R antigen

Sign In for Pricing
View Details
CD184 Antibody
orb623084 0.1 mg

CD184 Antibody

Sign In for Pricing
View Details
Cellulose, microcrystalline powder, 90 micron
GV9019-25g 25 g

Cellulose, microcrystalline powder, 90 micron

Sign In for Pricing
View Details
Gtf3c3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4555806 1.0 µg DNA

Gtf3c3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Phospho-PDGFRA-Y1018 Rabbit pAb
E45R01029N 50 ul

Phospho-PDGFRA-Y1018 Rabbit pAb

Sign In for Pricing
View Details