Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3)

This Recombinant Pongo abelii Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) spans the amino acid sequence from region 1-383.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 3

UniProt

Q5R8G3

Expression Region

1-383

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYV DKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAE RHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVRETYRRRGWAFKNPDTIE QCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNI NMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQF SVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAG LIDSLIYHSARAIQKKIDLGKTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ephrin A4 (EFNA4) activation kit by CRISPRa
GA101344 1 Kit

Human Ephrin A4 (EFNA4) activation kit by CRISPRa

Sign In for Pricing
View Details
FYB1 (NM_199335) Human Recombinant Protein
TP320537 20 µg

FYB1 (NM_199335) Human Recombinant Protein

Sign In for Pricing
View Details
NFYC Rabbit Polyclonal Antibody
TA379110 100 µL

NFYC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS509706 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
GFOD1 Human Gene Knockout Kit (CRISPR)
KN415584 1 Kit

GFOD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Purified Anti-Rat CD90 Antibody[OX-7]
E-AB-F1226A-01 25 µg

Purified Anti-Rat CD90 Antibody[OX-7]

Sign In for Pricing
View Details