Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Endoplasmic reticulum-Golgi intermediate compartment protein 3 (Ergic3)

This Recombinant Mouse Endoplasmic reticulum-Golgi intermediate compartment protein 3 (Ergic3) spans the amino acid sequence from region 1-383.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 3, Serologically defined breast cancer antigen NY-BR-84 homolog

UniProt

Q9CQE7

Expression Region

1-383

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYV DKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKKRLDKDGVPVSSEAE RHELGKVEVTVFDPNSLDPNRCESCYGAESEDIKCCNSCEDVREAYRRRGWAFKNPDTIE QCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNI NMTHYIKHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQF SVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAG LIDSLIYHSARAIQKKIDLGKTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KGF Rabbit mAb
orb1922494-01 20 ul

KGF Rabbit mAb

Sign In for Pricing
View Details
KGF Rabbit mAb
orb1922494-02 50 µL

KGF Rabbit mAb

Sign In for Pricing
View Details
KGF Rabbit mAb
orb1922494-03 100 µL

KGF Rabbit mAb

Sign In for Pricing
View Details
SNAP23 Conjugated Antibody
C40111 100 µL

SNAP23 Conjugated Antibody

Sign In for Pricing
View Details
Slc4a7 AAV siRNA Pooled Vector
44224164 1.0 µg

Slc4a7 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mmu-miR-666-3p mimic
HY-R03449-01 5 nmol

Mmu-miR-666-3p mimic

Sign In for Pricing
View Details