Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Endoplasmic reticulum-Golgi intermediate compartment protein 3 (Ergic3)

This Recombinant Mouse Endoplasmic reticulum-Golgi intermediate compartment protein 3 (Ergic3) spans the amino acid sequence from region 1-383.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 3, Serologically defined breast cancer antigen NY-BR-84 homolog

UniProt

Q9CQE7

Expression Region

1-383

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYV DKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKKRLDKDGVPVSSEAE RHELGKVEVTVFDPNSLDPNRCESCYGAESEDIKCCNSCEDVREAYRRRGWAFKNPDTIE QCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNI NMTHYIKHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQF SVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAG LIDSLIYHSARAIQKKIDLGKTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Danio rerio Probable phosphatase phospho1 (phospho1)
MBS1417623-01 0.02 mg (E-Coli)

Recombinant Danio rerio Probable phosphatase phospho1 (phospho1)

Sign In for Pricing
View Details
Recombinant Danio rerio Probable phosphatase phospho1 (phospho1)
MBS1417623-02 0.02 mg (Yeast)

Recombinant Danio rerio Probable phosphatase phospho1 (phospho1)

Sign In for Pricing
View Details
Recombinant Danio rerio Probable phosphatase phospho1 (phospho1)
MBS1417623-03 0.1 mg (E-Coli)

Recombinant Danio rerio Probable phosphatase phospho1 (phospho1)

Sign In for Pricing
View Details
Recombinant Danio rerio Probable phosphatase phospho1 (phospho1)
MBS1417623-04 0.1 mg (Yeast)

Recombinant Danio rerio Probable phosphatase phospho1 (phospho1)

Sign In for Pricing
View Details
Recombinant Danio rerio Probable phosphatase phospho1 (phospho1)
MBS1417623-05 0.02 mg (Baculovirus)

Recombinant Danio rerio Probable phosphatase phospho1 (phospho1)

Sign In for Pricing
View Details
Recombinant Danio rerio Probable phosphatase phospho1 (phospho1)
MBS1417623-06 0.02 mg (Mammalian-Cell)

Recombinant Danio rerio Probable phosphatase phospho1 (phospho1)

Sign In for Pricing
View Details