Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Kluyveromyces lactis Protein ERD1 (ERD1)

This Recombinant Kluyveromyces lactis Protein ERD1 (ERD1) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

Protein ERD1

UniProt

P41771

Expression Region

1-384

Origin

Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAESVEPFLVYLPIPQRVVVLVLLGLWLWTWFLKVSVSYYDVSKVIVSNESTGLPYFNT STKIHQSSLKLFKSISRVIIPWQLVCIILFQYSFTNNVSNKLLWFFLNVSPLLELFYIFA MILRSSAMVARCFKRILWVADIEPKPYRNNYIIISDTLTSYSKPLVDLAIYATFLFHDPT NVKCQVERYENAISLNIDVLVGVLPSLVRMIQSLREFTRGRSQKKDGSQLFNAFKYAGNI PIMLVTVYTRYYNLGPLGMMYWFMFWNSAYSFWWDVTMDWKLELFDFVNGDTSVNNNNSS NKADGLLRSILLYRKNAWYYSAMALDFILRFVWFWEYISGHSVFYGELNIFWLQILEIIR RWIWLFFKVEVEYIATTEGGKMDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphoric Acid Impurity 10
RM-P281010-01 10 mg

Phosphoric Acid Impurity 10

Sign In for Pricing
View Details
Phosphoric Acid Impurity 10
RM-P281010-02 25 mg

Phosphoric Acid Impurity 10

Sign In for Pricing
View Details
Phosphoric Acid Impurity 10
RM-P281010-03 50 mg

Phosphoric Acid Impurity 10

Sign In for Pricing
View Details
Phosphoric Acid Impurity 10
RM-P281010-04 100 mg

Phosphoric Acid Impurity 10

Sign In for Pricing
View Details
KRT35 Polyclonal Antibody, HRP Conjugated
A67083-100 100 µL

KRT35 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
METTL9 Human Gene Knockout Kit (CRISPR)
KN400028 1 Kit

METTL9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details