Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein C05B5.2 (C05B5.2)

This Recombinant Uncharacterized protein C05B5.2 (C05B5.2) spans the amino acid sequence from region 1-385.

Product Specifications

Product Name Alternative

Uncharacterized protein C05B5.2

UniProt

P34290

Expression Region

1-385

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNIVLIIGLLAIFNTSSASNDVCHVTRKPLMLPAPGDVYKKAVQFYSNITAPRSTSVLA PVMSSLEVYINTTTTSAFAPAQSIKVADILEEDADAIRVKSIRMAGFIAQCIIFLFVYTI VTMDVEIWKINMDWLKIQYFQHFEDSAAEVPVFKLYMAREIQTCPLPARQNVMILSLIKH IAFIGFQFWLTKPPVARRMTFLKLAIQVLRIPFLFFIAFRAFIIPKFIFLETGSYVATGL FSAFHLTILWIHMNPKSLKSLYYAYIALTVLMLTGWFDFVFRKHCFLKKYGFLVAMGIAG NVPNSREVTMIIELDMLSLTLTLVLLYLQLKKSVAEEFVFPKQPKKSIRGPVCFTNTLTE DNEGYFENIYGDLIFTSRTSNTFSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SF20, mouse recombinant
4334-1000 1 mg

SF20, mouse recombinant

Sign In for Pricing
View Details
Anti-GOLPH3 Antibody Picoband®, iFluor647 Conjugate
A01333-1-iFluor647 100 µg

Anti-GOLPH3 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
Lentiviral mouse Mmp1a shRNA (UAS) - Lentiviral mouse Mmp1a shRNA (UAS) (100)
GTR15283350 1 Vial

Lentiviral mouse Mmp1a shRNA (UAS) - Lentiviral mouse Mmp1a shRNA (UAS) (100)

Sign In for Pricing
View Details
Rat Pituitary Adenylate Cyclase Activating Peptide 38 ELISA Kit
MBS7276090-01 48 Well

Rat Pituitary Adenylate Cyclase Activating Peptide 38 ELISA Kit

Sign In for Pricing
View Details
Rat Pituitary Adenylate Cyclase Activating Peptide 38 ELISA Kit
MBS7276090-02 96 Well

Rat Pituitary Adenylate Cyclase Activating Peptide 38 ELISA Kit

Sign In for Pricing
View Details
Rat Pituitary Adenylate Cyclase Activating Peptide 38 ELISA Kit
MBS7276090-03 5x 96 Well

Rat Pituitary Adenylate Cyclase Activating Peptide 38 ELISA Kit

Sign In for Pricing
View Details