Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Suid herpesvirus 1 Envelope glycoprotein D

This Recombinant Suid herpesvirus 1 Envelope glycoprotein D spans the amino acid sequence from region 18-402.

Product Specifications

Product Name Alternative

Envelope glycoprotein D, gD, Protein gp50

UniProt

P07645

Expression Region

18-402

Origin

Suid herpesvirus 1 (strain Rice) (SuHV-1) (Pseudorabies virus (strain Rice) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ADVDAVPAPTFPPPAYPYTESWQLTLTTVPSPFVGPADVYHTRPLEDPCGVVALISDPQV DRLLNEAVAHRRPTYRAHVAWYRIADGCAHLLYFIEYADCDPRQVFGRCRRRTTPMWWTP SADYMFPTEDELGLLMVAPGRFNEGQYRRLVSVDGVNILTDFMVALPEGQECPFARVDQH RTYKFGACWSDDSFKRGVDVMRFLTPFYQQPPHREVVNYWYRKNGRTLPRAHAAATPYAI DPARPSAGSPRPRPRPRPRPRPKPEPAPATPAPPDRLPEPATRDHAAGGRPTPRPPRPET PHRPFAPPAVVPSGWPQPAEPFQPRTPAAPGVSRHRSVIVGTGTAMGALLVGVCVYIFFR LRGAKGYRLLGGPADADELKAQPGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Fas/TNFRSF6/CD95 (C-6His)
CP49-50ug 50 µg

Recombinant Mouse Fas/TNFRSF6/CD95 (C-6His)

Sign In for Pricing
View Details
0610007L01Rik 3'UTR Lenti-reporter-Luc Vector
10002084 1.0 µg

0610007L01Rik 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
PHF20 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
36566154 3x 1.0 µg DNA

PHF20 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
[Des-Pro2]Bradykinin
5-00175 4x 5 mg

[Des-Pro2]Bradykinin

Sign In for Pricing
View Details
BTG2 (BTG Family, Member 2, MGC126063, MGC126064, PC3, TIS21) (MaxLight 750) discontinued
243915-ML750 100 µL

BTG2 (BTG Family, Member 2, MGC126063, MGC126064, PC3, TIS21) (MaxLight 750) discontinued

Sign In for Pricing
View Details
TMEM38B Protein Vector (Rat) (pPM-C-HA)
47045026 500 ng

TMEM38B Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details