Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Suid herpesvirus 1 Envelope glycoprotein D

This Recombinant Suid herpesvirus 1 Envelope glycoprotein D spans the amino acid sequence from region 18-402.

Product Specifications

Product Name Alternative

Envelope glycoprotein D, gD, Protein gp50

UniProt

P07645

Expression Region

18-402

Origin

Suid herpesvirus 1 (strain Rice) (SuHV-1) (Pseudorabies virus (strain Rice) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ADVDAVPAPTFPPPAYPYTESWQLTLTTVPSPFVGPADVYHTRPLEDPCGVVALISDPQV DRLLNEAVAHRRPTYRAHVAWYRIADGCAHLLYFIEYADCDPRQVFGRCRRRTTPMWWTP SADYMFPTEDELGLLMVAPGRFNEGQYRRLVSVDGVNILTDFMVALPEGQECPFARVDQH RTYKFGACWSDDSFKRGVDVMRFLTPFYQQPPHREVVNYWYRKNGRTLPRAHAAATPYAI DPARPSAGSPRPRPRPRPRPRPKPEPAPATPAPPDRLPEPATRDHAAGGRPTPRPPRPET PHRPFAPPAVVPSGWPQPAEPFQPRTPAAPGVSRHRSVIVGTGTAMGALLVGVCVYIFFR LRGAKGYRLLGGPADADELKAQPGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATPase 2, Ca2+ Transporting, Sarcoplasmic Endoplasmic Reticulum (SERCA2) (MaxLight 490)
A4000-94A-ML490 100 µL

ATPase 2, Ca2+ Transporting, Sarcoplasmic Endoplasmic Reticulum (SERCA2) (MaxLight 490)

Sign In for Pricing
View Details
DJ1 antibody
10R-8564 100 ul

DJ1 antibody

Sign In for Pricing
View Details
Recombinant Bovine Integrin beta-5 (ITGB5)
orb2901929-01 20 µg

Recombinant Bovine Integrin beta-5 (ITGB5)

Sign In for Pricing
View Details
Recombinant Bovine Integrin beta-5 (ITGB5)
orb2901929-02 100 µg

Recombinant Bovine Integrin beta-5 (ITGB5)

Sign In for Pricing
View Details
Anti-ITPKB antibody
STJ24265 100 µl

Anti-ITPKB antibody

Sign In for Pricing
View Details
Fibronectin-Binding Protein
sc-396177 0.5 mg

Fibronectin-Binding Protein

Sign In for Pricing
View Details