Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Monopolar spindle protein 2 (MPS2)

This Recombinant Saccharomyces cerevisiae Monopolar spindle protein 2 (MPS2) spans the amino acid sequence from region 1-387.

Product Specifications

Product Name Alternative

Monopolar spindle protein 2

UniProt

C8Z8H2

Expression Region

1-387

Origin

Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNGAFDAIFEYAWGQIDKPISGDFIYGKDLPKLIEIIENIFQKAQKSGSYELRLPLFSE INKDLFRTFSNTKTFFKIHKEEFDDIFFNLVNHPLREILENAFIGVDSIPSDFIVSMNLN SPSKFLVENKSKNTEGAGISTPRKKLTESPIKLLSRNNIGKALEVQVEELKRELTAKQSL LQENERQVSELKIRLETYQEKYASIQQRFSDLQKARQVEDNQNSSRTSDPGSPLVTGIDQ KAILEEFRRRLQRQTDTISFLKDQIRRERGLNCSNDKVSHSKRKHATTDGDGTFKNFISA VPSNIWVKATIRIIVCFALLAGVLPYIRKYVYAHDTPSQNSRLQLSWWENSGILSKIVWF FEDQTDLETEYRSNANVDDAYSRVFGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF647 conjugate, 0.1mg/mL
BNC470160-500 1x 500 µL

CD20 (B9E9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL
BNC470633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
BNC470026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL
BNC040806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL
BNC881429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TOX3 (TOX3/1124), CF405S conjugate, 0.1mg/mL
BNC041124-500 1x 500 µL

TOX3 (TOX3/1124), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details