Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Short-chain dehydrogenase/reductase family 42E member 1 (sdr42e1)

This Recombinant Danio rerio Short-chain dehydrogenase/reductase family 42E member 1 (sdr42e1) spans the amino acid sequence from region 1-387.

Product Specifications

Product Name Alternative

Short-chain dehydrogenase/reductase family 42E member 1, EC= 1.1.1.-

UniProt

A8DZE7

Expression Region

1-387

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVNRKDNSFLITGGGGYFGFRLACALLKTSSKVVLFDVSPPIQDLPEGLIFMRADIRDY AQVEKAVRGSHCVFHIASYGMSGREQLNRKLIEEVNVKGTENILRACVAHSVPRLIYTST FNVVFGGQEIKNGDESLPYLPLHLHPDHYSRTKSIAEMQVLKANNLALSNSTGVLRTCAL RPAGIYGPGEQRHLPRIVSYIENGIFRFVYGDPDSLVEFVHVDNLVSAHLLAADALTEKQ QCRAAGQAYFISDGRPVNNFEFFRPLVEGLGYSFPTLRLPISMIYFFAFLTEMVHFVVGR IYNFQPLLTRTEVYKTGVTHYFSMRKAREELGYEPKLYDLEDVVQWFQARGHGKKRSRSS IRKLILDVFVVVAFVAVLLSCLPVVGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
BNC740391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL
BNC700745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
BNC740026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL
BNC400158-100 1x 100 µL

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL
BNC881429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF568 conjugate, 0.1mg/mL
BNC681045-500 1x 500 µL

CD16 (C16/1045), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details