Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Putative type II secretion system protein L (gspL)

This Recombinant Escherichia coli Putative type II secretion system protein L (gspL) spans the amino acid sequence from region 1-387.

Product Specifications

Product Name Alternative

Putative type II secretion system protein L, T2SS protein L, Putative general secretion pathway protein L

UniProt

P45763

Expression Region

1-387

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPESLMVIRSSSTLRKHWEWMTFSADSVSSVHTLTDDLPLESLADQPGAGNVHLLIPPEG LLYRSLTLPNAKYKLTAQTLQWLAEETLPDNTQDWHWTVVDKQNESVEVIGIQSEKLSRY LERLHTAGLNVTRVLPDGCYLPWEVDSWTLVNQQTSWLIRSAAHAFNELDEHWLQHLAAQ FPPENMLCYGVVPHGVAAANPLIQHPEIPSLSLYSADIAFQRYDMLHGIFRKQKTVSKSG KWLARLAVSCLVLAILSFVGSRSIALWHTLKIEDQLQQQQQETWQRYFPQIKRTHNFRFY FKQQLAQQYPEAVPLLYHLQTLLLEHPELQLMEANYSQKQKSLTLKMSAKSEANIDRFCE LTQSWLPMEKTEKDPVSGVWTVRNSGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC81 Antibody
KC-3817-01 50 μL

CCDC81 Antibody

Sign In for Pricing
View Details
CCDC81 Antibody
KC-3817-02 100 µL

CCDC81 Antibody

Sign In for Pricing
View Details
CCDC81 Antibody
KC-3817-03 1 mL

CCDC81 Antibody

Sign In for Pricing
View Details
c Fos (FOS) Mouse Monoclonal Antibody [Clone ID: OTI7D6]
CF806977 100 µg

c Fos (FOS) Mouse Monoclonal Antibody [Clone ID: OTI7D6]

Sign In for Pricing
View Details
Galectin 3 (LGALS3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F1]
TA804567BM 100 µL

Galectin 3 (LGALS3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F1]

Sign In for Pricing
View Details
MTMR2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F10]
TA502200AM 100 µL

MTMR2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F10]

Sign In for Pricing
View Details